SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184326|ref|YP_008957022.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184326|ref|YP_008957022.1|
Domain Number 1 Region: 38-133
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000418
Family Multidrug resistance efflux transporter EmrE 0.0056
Further Details:      
 
Domain Number 2 Region: 179-276
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000144
Family Multidrug resistance efflux transporter EmrE 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568184326|ref|YP_008957022.1|
Sequence length 277
Comment transporter [Pseudomonas monteilii SB3078]
Sequence
MLATSLVLVAALLHATWNTLIKFSGERLLVIASMDTVALAFAVLAVPFVEVPPTNIWPWL
LASALAEQLYRFLLIQAYRVGDLGLVYPLMRGLSPLVVLGLTLAFAGESLSQQQIIGILL
IPCGMACLLWQGGGGDRLPWSMLPVVALIGLCIGCYTWFDGQAVRLWGKPWDYLVWLTLL
SAWPFPLLASVARRAPFVLFWRLQWRLGLAVGLCVLLSYALVLWAMHLGSVAEAAALREL
SVILVVLLGMRYLKEPFGGPRLLACGLVLAGMLVMKL
Download sequence
Identical sequences A0A099N6Q4 A0A1S2JTM2 F8FU55 V7DEU3 V9V5R8
gi|568189699|ref|YP_008962385.1| WP_013974510.1.23948 WP_013974510.1.28354 WP_013974510.1.56258 WP_013974510.1.65739 WP_013974510.1.7288 WP_013974510.1.80759 gi|568184326|ref|YP_008957022.1| gi|339489698|ref|YP_004704226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]