SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184335|ref|YP_008957031.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184335|ref|YP_008957031.1|
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.12e-39
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568184335|ref|YP_008957031.1|
Sequence length 183
Comment cytochrome B561 [Pseudomonas monteilii SB3078]
Sequence
MQLRNSSSRYGVVSIVLHWGVALAVFGLFGLGLWMVGLDYYSPWRKAGPDLHKSIGLVLL
AVMLLRVLWRFISPPPPAPASHGAFTRLAAKLGHLALYLGLFAVMIAGYLISTADGVGIP
VFGMFEVPALVSDLPDQANLAGVIHLWLAWGLVIFAVLHGLAALKHHFIDRDATLTRMLG
RKA
Download sequence
Identical sequences F8FVB4 V9V8U5
gi|339489707|ref|YP_004704235.1| gi|568184335|ref|YP_008957031.1| WP_013974518.1.23948 WP_013974518.1.28354 WP_013974518.1.56258 WP_013974518.1.65739 WP_013974518.1.7288 gi|568189708|ref|YP_008962394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]