SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184379|ref|YP_008957075.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184379|ref|YP_008957075.1|
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily DTD-like 1.11e-54
Family DTD-like 0.00000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184379|ref|YP_008957075.1|
Sequence length 145
Comment D-tyrosyl-tRNA(Tyr) deacylase [Pseudomonas monteilii SB3078]
Sequence
MRGLLQRVRGARVEVAGEVVGAIDQGLLVLVAVEPEDSREQADKLLHKLLNYRVFSDEQG
KMNLSLKDVGGGLLLVSQFTLAADTRNGMRPSFSTAAPPALGAELFDYLLQQAKARHADV
ASGQFGADMQVHLVNDGPVTFMLQI
Download sequence
Identical sequences A0A099N7P6 A0A0P7DBU6 F8FVF8 L0FRZ2 V7D5M0 V9V463
gi|568184379|ref|YP_008957075.1| gi|431804848|ref|YP_007231751.1| gi|568189752|ref|YP_008962438.1| gi|339489751|ref|YP_004704279.1| WP_013974555.1.23948 WP_013974555.1.28354 WP_013974555.1.35716 WP_013974555.1.56258 WP_013974555.1.57632 WP_013974555.1.65739 WP_013974555.1.71677 WP_013974555.1.7288 WP_013974555.1.80759 WP_013974555.1.95946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]