SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184422|ref|YP_008957120.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184422|ref|YP_008957120.1|
Domain Number 1 Region: 445-1187
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.51e-251
Family FMN-linked oxidoreductases 0.00000000000185
Further Details:      
 
Domain Number 2 Region: 15-431
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.14e-141
Family Class II glutamine amidotransferases 0.0000000225
Further Details:      
 
Domain Number 3 Region: 1213-1466
Classification Level Classification E-value
Superfamily Alpha subunit of glutamate synthase, C-terminal domain 1.7e-88
Family Alpha subunit of glutamate synthase, C-terminal domain 0.000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568184422|ref|YP_008957120.1|
Sequence length 1481
Comment glutamate synthase subunit alpha [Pseudomonas monteilii SB3078]
Sequence
MKTGLYHPEEFKDNCGFGLIAHMTGEPSHHLLQTAMQALTCMTHRGGINADGKTGDGCGL
LMQKPDQFLRAVAQEHFAVELPKQYAVGMVFFNQDSVKAEAARANMDREILAAGLKLVGW
RKVPIDTSVLGRLALERLPQIEQVFIGGEGLSDQEFAIKLFSARRRSSVANAHDADHYIC
SFSHKTIIYKGLMMPRDLAVFYPDLGDERLQTAICVFHQRFSTNTLPKWPLAQPFRFLAH
NGEINTITGNRNWAMARRTKFANDLIPDLEELGPLVNRVGSDSSSMDNMLELMVTGGIDL
FRGVRMLVPPAWQNVETMDADLRAFYEYNSMHMEPWDGPAGIVMTEGRHAVCLLDRNGLR
PARWVTTKNGYITLASEIGVWDYKPEDVIAKGRVGPGQIFAVDTETGQILDTDAIDNRLK
SRHPYKRWLRQHATRIQATLTDDQGVASYDADQLKQYMKMFQVTFEERDQVLRPLGEQGQ
EAVGSMGDDTPMAVLSQRVRSPYDFFRQQFAQVTNPPIDPLREAIVMSLEICLGAERNIF
QESPEHASRVILSSPVISPAKWRSLMNLEREGFDRQLIDLNYEESVGLEAAIRNIADQAE
EAVRAGKTQLVLSDRYIAPGKLPVHASLAVGAVHHRLTEQGLRCDSNILVETATARDPHH
FAVLLGFGASAVYPYLAYEVLADLIRTGEVLGDLDEVFKYYRKGISKGLLKILSKMGIST
IASYRGAQLFEAIGLSEEVVGLSFKGVSSRIKGARFADLESDQKLLAAEAWSARKPIQQG
GLLKFVHGGEYHAYNPDVVNTLQAAVQQGDYAKFKEYTTLVDQRPVSMIRDLLKVKVADQ
PLPLEQIEPLEAILKRFDSAGISLGALSPEAHEALAEAMNRLGARSNSGEGGEDPARYGT
IKSSKIKQVATGRFGVTPEYLVNAEVLQIKVAQGAKPGEGGQLPGGKVNGLIAKLRYAVP
GVTLISPPPHHDIYSIEDLAQLIYDLKQVNPQALVSVKLVAEAGVGTIAAGVAKAYADLI
TISGYDGGTGASPLTSIKYAGAPWELGLAETHQTLRGNDLRGKVRVQTDGGLKTGLDVIK
AAILGAESFGFGTAPMIALGCKYLRICHLNNCATGVATQNDKLRKDHYIGTVDMVINFFT
FVAEETREWLAKLGVRSLGELIGRTDLLDVLPGDTERQQYLDLTPLLGSSHIPADKPQFC
EVDKNPPFDQGELAEKMVEMAMPAIRDQAGGEFSLDICNCDRSIGARVSGEIARLHGNQG
MAAAPITFRFKGTAGQSFGVWNAGGLNLHLEGDANDYVGKGMTGGKVTIVPPAGSPFETQ
HSAIVGNTCLYGATGGKLFAAGTAGERFAVRNSGAHAVVEGTGDHCCEYMTGGFVCVLGK
TGYNFGSGMTGGFAYVLDMDNTFVDKLNHELVEIQRISGEAMEAYRSHLARVLAEYVEET
GSEWGRELSENLDDYVRRFWLVKPKAANLKQLLSSTRANPQ
Download sequence
Identical sequences V9V6N3
gi|568189795|ref|YP_008962483.1| gi|568184422|ref|YP_008957120.1| WP_024087851.1.23948 WP_024087851.1.28354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]