SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184429|ref|YP_008957127.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184429|ref|YP_008957127.1|
Domain Number 1 Region: 212-234,263-314,419-607,652-795
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.13e-128
Family beta-Lactamase/D-ala carboxypeptidase 0.00039
Further Details:      
 
Domain Number 2 Region: 44-256
Classification Level Classification E-value
Superfamily Lysozyme-like 1.49e-75
Family PBP transglycosylase domain-like 0.00000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568184429|ref|YP_008957127.1|
Sequence length 817
Comment peptidase [Pseudomonas monteilii SB3078]
Sequence
MIRLLKFFWWSSVAVICALVLGVSGAFLYLSPNLPSVESLRSIQLQIPLRVYSSDGKLIA
EFGEMRRSPIRFEEIPPQFIQALLSAEDDNFLNHYGVDPSSLMRAATQLVKTGHIQTGGS
TITMQVAKNFFLTSERSFSRKTNEILLALQIERELTKDEILELYVNKIYLGNRAYGIDAA
AQVYYGKSIRDVSLAQMAMIAGLPKAPSRFNPLANPVRAKERRDWILGRMYKLGKIDEAS
YQAALAEPLNASYHVPTPEVNAPYIAEMARAEMVGRYGSDAYTEGFRVTTTVPSDMQEMA
NKAILNGLSDYDERHGYRGPEARFPGRTQAAWLQELGKQRSLGGLEPVIVTQVEKTGLKV
LTRSGQEEQVAWDTMKWARPFINSNSQGRAPQSPADVAQVGDLVRVQRLEDGKFKFSQVP
GAQSALVTLDPYNGAIRALVGGFSFEQSNYNRAMQAKRQPGSSFKPFIYSAALDSGYTAS
SLVNDAPIVFVDEYLDKVWRPKNDTNTFLGPIRMREALYKSRNLVSIRLLQAMGVDRTID
YIAKFGFNKQDLPRNLSLALGTATLTPMEIATGWSTFANGGYKITPYLIERIESRSGETL
FTANPARVPQGAEDQAGVAAPEQPISTTAMPGEAPAAFSQVASAPQAPAVAERIIDGRTT
YILTSMLQDVIKRGTGRRALALGRTDLAGKTGTTNESKDAWFSGYNADYVTTVWVGFDQP
ETLGRREYGGTAALPIWMSFMGAALKDKPAHAPAEPEGILSLRVDPVSGRAASPSTPNAY
FELFKAEDSPPSVDELGTGAAPGSPLPADEAAPMDLF
Download sequence
Identical sequences A0A099N5L8 V7D5X8 V9V4A3
WP_023662592.1.23948 WP_023662592.1.28354 WP_023662592.1.65739 WP_023662592.1.7288 WP_023662592.1.80759 gi|568184429|ref|YP_008957127.1| gi|568189802|ref|YP_008962490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]