SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184502|ref|YP_008957201.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184502|ref|YP_008957201.1|
Domain Number 1 Region: 4-217
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.73e-69
Family FAD-linked oxidases, N-terminal domain 0.0055
Further Details:      
 
Domain Number 2 Region: 222-463
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 8.67e-61
Family Vanillyl-alcohol oxidase-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568184502|ref|YP_008957201.1|
Sequence length 465
Comment FAD-linked oxidase [Pseudomonas monteilii SB3078]
Sequence
MTHPAVIDELMTLVDPGKVLTDAASLEAYGKDWTKHYPPAPSAIVFPKTVEQVQAIVRWA
NTHKVALVPSGGRTGLSAGAVAANGEVVVAFDYMNQILGFNAFDRTVVCQPGVITRQLQA
YAEEQGLYYPVDFASSGSSQIGGNIGTNAGGIKVIRYGMTRNWVAGLKVVTGKGELLELN
KDLIKNATGYDLRQLFIGAEGTLGFVVEATMRLDRAPRNLTAMVLGTPDFDSIMPVLHAF
QGKLDLTAFEFFSDKGLARILARGDVPAPFETDCPFYALLEFEASTEEVANEALATFEHC
VEQGWVLDGVMSQSETQLKSLWKLREYLSETISHWTPYKNDISVTVSKVPAFLRDIDAIV
AEHYPDYEVVWYGHIGDGNLHLNILKPEHMSKDDFFASCTKVNKWVFEIVERYNGSISAE
HGVGMTKRDYLGYSRSPEEIACMKAIKAVFDPNGIMNPGKIFAPE
Download sequence
Identical sequences V9V6V0
gi|568189875|ref|YP_008962564.1| gi|568184502|ref|YP_008957201.1| WP_024087877.1.23948 WP_024087877.1.28354 WP_024087877.1.65739 WP_024087877.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]