SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184632|ref|YP_008957335.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184632|ref|YP_008957335.1|
Domain Number 1 Region: 184-401
Classification Level Classification E-value
Superfamily CoaB-like 1.83e-76
Family CoaB-like 0.00000146
Further Details:      
 
Domain Number 2 Region: 1-178
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.84e-61
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184632|ref|YP_008957335.1|
Sequence length 403
Comment phosphopantothenate synthase [Pseudomonas monteilii SB3078]
Sequence
MQRLYRKRIVLGVGGGIAAYKSAELIRRLLEHGAQVRVVMTRGGAEFITPLTLQALSGHP
VHMDLLDPAAEAAMGHIELAKWADLVLIAPATADLMARMAQGMADDLLTTLVLATDATVA
VAPAMNQAMWRDPATQANLELLKSRGIQVFGPASGSQACGDVGLGRMLEATDLAWCAAES
FKRQALTGKHVLITAGPTQENIDPVRYITNHSSGKMGFALAEAAAEAGARVTLVTGPVHL
PTPDRVSRIDVVSARDMLAACEAAMPCDLFIASAAVADYRPEVVATQKLKKDPTTGDGML
LQMVRNPDILATIAGRADRPFSVGFAAETEHLLDYATRKLKDKNLDLIVANDVANPSIGF
NSEENALTVIDRQQHQTLFAQTSKGKIARQLVAFIAERLNQVQ
Download sequence
Identical sequences A0A0A7PUL3 A0A0E9ZR17 A0A0M2US40 A0A0P7DEF3 A0A0Q4NQ88 A0A136QD54 A0A160J3L7 A0A173H892 A0A1L5PXZ3 A0A2A3M6L4 A0A2I0CJ52 A0A2K4LQZ3 I7CF68 L0FTP9 V9V768 V9X3U1
WP_003253409.1.100978 WP_003253409.1.11138 WP_003253409.1.12409 WP_003253409.1.1643 WP_003253409.1.23948 WP_003253409.1.25319 WP_003253409.1.25626 WP_003253409.1.28354 WP_003253409.1.31851 WP_003253409.1.32670 WP_003253409.1.32932 WP_003253409.1.33269 WP_003253409.1.33725 WP_003253409.1.35335 WP_003253409.1.41 WP_003253409.1.41505 WP_003253409.1.42045 WP_003253409.1.42658 WP_003253409.1.44137 WP_003253409.1.45427 WP_003253409.1.47320 WP_003253409.1.48025 WP_003253409.1.52768 WP_003253409.1.5613 WP_003253409.1.56258 WP_003253409.1.57632 WP_003253409.1.59340 WP_003253409.1.60844 WP_003253409.1.61620 WP_003253409.1.65173 WP_003253409.1.65739 WP_003253409.1.675 WP_003253409.1.71677 WP_003253409.1.7288 WP_003253409.1.73516 WP_003253409.1.74642 WP_003253409.1.75189 WP_003253409.1.76210 WP_003253409.1.76710 WP_003253409.1.78345 WP_003253409.1.80759 WP_003253409.1.89748 WP_003253409.1.92076 WP_003253409.1.9402 WP_003253409.1.96951 WP_003253409.1.98117 gi|568190005|ref|YP_008962698.1| gi|397697440|ref|YP_006535323.1| gi|431805161|ref|YP_007232064.1| gi|568184632|ref|YP_008957335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]