SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184666|ref|YP_008957369.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184666|ref|YP_008957369.1|
Domain Number 1 Region: 227-368
Classification Level Classification E-value
Superfamily CBS-domain pair 1.89e-26
Family CBS-domain pair 0.0026
Further Details:      
 
Domain Number 2 Region: 367-445
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000131
Family CorC/HlyC domain-like 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|568184666|ref|YP_008957369.1|
Domain Number - Region: 102-175
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0549
Family Bacteriorhodopsin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568184666|ref|YP_008957369.1|
Sequence length 446
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MDPSPGISLTSLFADFGMIIFALLLVLLNGFFVAAEFAMVKLRATRVESIAELHGWRGSI
LRKVHNQLDAYLSACQLGITLASLGLGWVGEPAFAHLLEPLLAYLGVDTPELIKAISFFV
AFFVISYLHIVVGELAPKSWAIRKPELLSLWTAVPLYLFYWVMYPAIYLLNASANTILRI
AGQGEPGPHHEHHYSREELKLILHSSRGQDPSDQGMRVLASAVEMGELEVVDWANSREDM
VSIDAHAPLKQILALVRRHKFSRYPVYDAEREEFTGLLHIKDLLLELAELEHLPETIDLD
DLARPLERVSRHMPLAQLLEQFRKGGAHFVLVEEADGKVIGYLTMEDVLEVLVGDIQDEH
RKTERGILAYQPGKLLVRGDTPLFKVERLLGVDLDHIEAETLAGLVYETLKRVPEEEEVL
EVEGLRIIIKKMKGPKIVLAKVLKLD
Download sequence
Identical sequences A0A059UZW4 A0A099N6B6 A0A0C1KME4 A0A0M2UQA3 A0A136QDI4 A0A1L5PY43 F8G0T5 L0FU13 V7DBS0 V9V6N6 V9X527
gi|568190039|ref|YP_008962732.1| WP_013974815.1.1643 WP_013974815.1.23948 WP_013974815.1.28354 WP_013974815.1.32670 WP_013974815.1.35335 WP_013974815.1.36363 WP_013974815.1.41505 WP_013974815.1.52768 WP_013974815.1.56258 WP_013974815.1.57632 WP_013974815.1.59340 WP_013974815.1.61620 WP_013974815.1.65739 WP_013974815.1.71677 WP_013974815.1.7288 WP_013974815.1.7435 WP_013974815.1.76210 WP_013974815.1.76710 WP_013974815.1.80759 WP_013974815.1.92076 WP_013974815.1.9402 WP_013974815.1.95946 WP_013974815.1.98117 WP_013974815.1.99927 gi|339490049|ref|YP_004704577.1| gi|568184666|ref|YP_008957369.1| gi|431805195|ref|YP_007232098.1| 2036019383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]