SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184696|ref|YP_008957399.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184696|ref|YP_008957399.1|
Domain Number 1 Region: 173-479
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 6.21e-115
Family Glucose 6-phosphate dehydrogenase-like 0.00000069
Further Details:      
 
Domain Number 2 Region: 4-186
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.87e-55
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184696|ref|YP_008957399.1|
Sequence length 480
Comment glucose-6-phosphate 1-dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MTIPCDILVFGGTGDLALHKLLPALYHLFREARLNNAVRIIALARRNLPRNDYLKLAERH
CRAQIARNDFDEEVWQRFSARVDYFAMDASQSADFGRLARYLGEPGGLTRIFYLATAPNL
FVPIAKHLHNAGLADTEARIVLEKPIGHSLESATAINEAIGAVLEENQVFRIDHYLGKET
VQNLMALRFANALLEPVWRNNQVDHVQISVCETLGVENRGAYYDRAGATRDMLQNHLLQL
LCLVAMEPPAQFEAEAVRDEKVKILRALKPITGQDVQDKTVRGQYGAGRIGGQEVPAYYF
EKDVDNDSDTETFIAIETHIDNWRWAGVPFYLRTGKRMARRSSQIVIQFKPVPHELFNGG
QVNQLLIQLQPDERISLRMMTKSPGKGMRLEPVDLDLNLAQVFSQTRRWDAYERLLLDVL
EGDSTLFMRRDEVEAAWAWIDPIIKGCEEHFQAPRPYPAGCNGPEQANSLLARHGRQWHS
Download sequence
Identical sequences A0A059V3Y9 A0A099N7U0 V7DG52 V9V6R8
WP_023660645.1.23948 WP_023660645.1.28354 WP_023660645.1.35335 WP_023660645.1.56258 WP_023660645.1.65739 WP_023660645.1.7288 WP_023660645.1.80759 gi|568190069|ref|YP_008962762.1| gi|568184696|ref|YP_008957399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]