SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184879|ref|YP_008957590.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184879|ref|YP_008957590.1|
Domain Number 1 Region: 510-915
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.45e-159
Family DNA polymerase I 0.000000000116
Further Details:      
 
Domain Number 2 Region: 311-503
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.22e-53
Family DnaQ-like 3'-5' exonuclease 0.000000741
Further Details:      
 
Domain Number 3 Region: 5-167
Classification Level Classification E-value
Superfamily PIN domain-like 1.35e-51
Family 5' to 3' exonuclease catalytic domain 0.00011
Further Details:      
 
Domain Number 4 Region: 168-289
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 3.89e-30
Family 5' to 3' exonuclease, C-terminal subdomain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184879|ref|YP_008957590.1|
Sequence length 915
Comment DNA polymerase I [Pseudomonas monteilii SB3078]
Sequence
MSQAPLVLVDGSSYLYRAFHALPPLTTSKGMPTGAVKGVLNMLKSLRKQYPDSLFAVVFD
AKGGTFRDAMFAEYKANRPSMPDDLRVQIEPLHASVKALGYPLLCVEGVEADDVIGTLAR
SSAALDRPVIISTGDKDMAQLVDGHITLVNTMTGSVLDVAGVHEKFGVGPEHIIDFLALM
GDKVDNIPGVPGVGEKTAVGLLTGIGGGLSDLYANLDKVPTLAIRGAKTLPAKLEEHRDA
AFLSYELATIKVDVPLDIEVDALVCGEPDRDALLALYTEMEFKSWIAEVQRDAAKAGDEI
APVAEQVAKVEPRYETILDQARFDFWLEKLRQAPLFAFDTETTGLDAQQAQLVGLSFAVE
PHEAAYVPLAHDYEGAPAQLDRTAVLLALKPLLEDPGKAKVGQNAKYDINILANGSPAIE
MRGVAYDTMLESYVLNSTATRHDMDSLAQKYLDHTTIAFEDIAGKGAKQLTFNQIHLDKA
GPYAAEDADITLRLHQALQARLAQTPSVQPVLMDIEMPLVPVLAKIERQGALVDAALLQV
QSGELGLKMAELEQRAYELAGEEFNLGSPKQLGAILYDKLGMPVLSKTTKGQPSTAEAVL
DELAEQGYPLPEVLMQYRSLSKLKSTYTDKLPGQINPRTGRIHTSYQQAVAATGRLSSSD
PNLQNIPIRTAEGRRIRQAFVASPGYKLLAADYSQIELRIMAHLAKDEGLLHAFRNNLDV
HRATAAEVFGVALEDVTTDQRRSAKAINFGLIYGMSAFGLAKQIGVDRKQSQDYIDRYFA
RYPGVLAYMERTRAQAAEQGFVETLFGRRLYLPDINAKNPALRKGAERTAINAPMQGTAA
DIIKRAMVNVDNWLSESGLDARVILQVHDELVLEVREDLVELVKDEIRQHMSKAAKLDVP
LLVEAGIGANWDEAH
Download sequence
Identical sequences A0A059URE5 A0A099N8D9 V9V793
gi|568190249|ref|YP_008962950.1| gi|568184879|ref|YP_008957590.1| WP_024087955.1.23948 WP_024087955.1.28354 WP_024087955.1.35335 WP_024087955.1.56258 WP_024087955.1.65739 WP_024087955.1.7288 WP_024087955.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]