SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568185076|ref|YP_008957790.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568185076|ref|YP_008957790.1|
Domain Number - Region: 30-89
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.0242
Family FMN-linked oxidoreductases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568185076|ref|YP_008957790.1|
Sequence length 294
Comment NADPH dependend quinone reductase [Pseudomonas monteilii SB3078]
Sequence
MNHDVIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGATVVHCHVRDPQTGRFSR
DVALYREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLEFGAGTDLIGPLERLAHVEA
LLPEICTLDCGTLNFGDGNSIYVSTPAQLRAGAKRITELGVKAELEIFDTGHLWFAKQMM
KEGLLEDPLFQLCLGIPWGAPADTTTMKAMVDNLPPNVTWAGFGIGRMQMPMAAQAVLLG
GNVRVGLEDNLYLDRGVLASNGQLVERAVEIISRLGARVLTPAEGREKMNLKRR
Download sequence
Identical sequences A0A059UUM4 A0A0C1KUI6 V9V9B6
gi|568190446|ref|YP_008963150.1| 2035935471 gi|568185076|ref|YP_008957790.1| WP_024088001.1.1643 WP_024088001.1.23948 WP_024088001.1.28354 WP_024088001.1.35335 WP_024088001.1.56258 WP_024088001.1.7288 WP_024088001.1.7435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]