SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568185085|ref|YP_008957800.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568185085|ref|YP_008957800.1|
Domain Number 1 Region: 4-370
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.23e-97
Family FMN-linked oxidoreductases 0.00000542
Further Details:      
 
Domain Number 2 Region: 380-683
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.98e-31
Family FAD-linked reductases, N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568185085|ref|YP_008957800.1|
Sequence length 686
Comment N-methylproline demethylase [Pseudomonas monteilii SB3078]
Sequence
MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKYYEEKAKGGIGLAICGG
SSVVAIDSPQEWWSSVNLSTDRIIPHFQNLADAMHKHGAKIMIQITHMGRRSRWDGFNWP
TLMSPSGIREPVHRATCKTIEVEEIWRVIGNYAQAARRAKEGGLDGVELSAVHQHMIDQF
WSPRVNKRTDEWGGTFEGRMKFGLEVLKAVRAEVGDDFCVGMRICGDEFHPDGLSHEDMK
QIAAYYDATGMLDFIGVVGSGCDTHNTLANVIPNMSYPPEPFLHLAAGIKEVVKVPVLHA
QNIKDPNQATRILEGGYVDMVGMTRAHMADPHLIAKIKMGQIDQIKQCVGANYCIDRQYQ
GLDVLCIQNAATSREYMGVPHIIEKTTGAKRKVVVVGAGPAGMEAARVAAERGHDVTLFE
KKEQIGGQITIAAKAPQRDQIAGITRWYQLELARLKVDLRLGTAADVAAIQDLRPDIIVL
AVGGHSFLEQNEHWGAAEGLVVSSWDVLDGKVAPGKNVLVYDTICEFTGMSVADFIADKG
SQVEIVTDDIKPGVAMGGTTFPTYYRSMYPKEVIMTGDMMLEKVYREGDKLVAVLENEYT
GAKEERVVDQVVVENGVRPDEQLYYALKEGSRNKGQIDVEALFAIKPQPILSQPGEGYLL
YRIGDCVAQRNVHAAIYDALRLCKDF
Download sequence
Identical sequences A0A059UPY8 A0A099N9S9 A0A0C1HZN3 F8FYD1 L0FF33 V7D9B6 V9V8E6
gi|568185085|ref|YP_008957800.1| gi|568190455|ref|YP_008963160.1| gi|339485241|ref|YP_004699769.1| WP_013970508.1.1643 WP_013970508.1.23948 WP_013970508.1.28354 WP_013970508.1.35335 WP_013970508.1.56258 WP_013970508.1.65739 WP_013970508.1.71677 WP_013970508.1.7288 WP_013970508.1.7435 WP_013970508.1.80759 gi|431800356|ref|YP_007227259.1| 2035935479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]