SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180480|ref|YP_008953005.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180480|ref|YP_008953005.1|
Domain Number 1 Region: 6-321
Classification Level Classification E-value
Superfamily SIS domain 9.79e-71
Family mono-SIS domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180480|ref|YP_008953005.1|
Sequence length 324
Comment D-arabinose 5-phosphate isomerase [Pseudomonas monteilii SB3078]
Sequence
MSQSSELIQSAQRTLRLELEAVEALLARIDDNFVKACELILASKGRVVVVGMGKSGHIGN
KIAATLASTGTPAFFVHPAEASHGDMGMITRDDVILALSNSGSTAEIVTLLPLIKRLGIK
LISLTGNPDSPLAQAAEVNLDARVEQEACPLNLAPTSSTTASLVLGDALAIALLEARGFT
AEDFAFSHPGGALGRRLLLKVENVMHAGDELPQVPRGTLLKDALLEMSRKGLGMTVIVEA
DGKLAGIFTDGDLRRSLDRNIDVHTTLIDQVMTVHGKTARAEMLAAEALKIMEDHKIGAL
VVVDREDRPTGALNMHDLLRAGVM
Download sequence
Identical sequences A0A059USW1 A0A0C1KKN2 A0A0M2UIF9 A0A136QKS1 A0A1L5PJU4 A0A2A3MAB9 J8VCB0 L0FDK2 V9UWL6 V9WTK8
gi|568180480|ref|YP_008953005.1| gi|431800974|ref|YP_007227877.1| WP_003257920.1.15314 WP_003257920.1.1643 WP_003257920.1.23948 WP_003257920.1.28354 WP_003257920.1.32670 WP_003257920.1.33515 WP_003257920.1.35335 WP_003257920.1.36363 WP_003257920.1.41505 WP_003257920.1.42658 WP_003257920.1.52768 WP_003257920.1.57632 WP_003257920.1.59340 WP_003257920.1.71677 WP_003257920.1.7435 WP_003257920.1.76210 WP_003257920.1.76710 WP_003257920.1.78427 WP_003257920.1.95946 WP_003257920.1.98117 WP_003257920.1.99927 gi|568185911|ref|YP_008958434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]