SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180839|ref|YP_008953367.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180839|ref|YP_008953367.1|
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.37e-35
Family Phosphoglucomutase, first 3 domains 0.00009
Further Details:      
 
Domain Number 2 Region: 260-365
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.37e-31
Family Phosphoglucomutase, first 3 domains 0.00075
Further Details:      
 
Domain Number 3 Region: 155-258
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 8.63e-29
Family Phosphoglucomutase, first 3 domains 0.00059
Further Details:      
 
Domain Number 4 Region: 370-453
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 9.77e-19
Family Phosphoglucomutase, C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568180839|ref|YP_008953367.1|
Sequence length 453
Comment phosphomannomutase [Pseudomonas monteilii SB3078]
Sequence
MYAPIQTRCFKAYDIRGQVPADLNDDIAYRIGRALVAELGGKCYVVGRDMRLESPGLSRA
LMKGLTEGGAEVIDIGLCGTEEVYFATSHYQADGGIMVTASHNPKGYNGMKLVREQSRPI
SGDTGLNDIRQRVEAGNLGTPGITPGVVREAFDKSAYIDHLLTYVDVSALKPLKVLADPG
NGAVGPVLELLKARLPLDITIINGEPDGNFPNGIPNPLLPENRDLTRQAVLDTGADMGIA
FDGDFDRCFFFDNQGRFIEGYYVVGLLAEMLLAKNPGSKIIHDPRLTWNTIEQVEAAGGI
AIQSKTGHAFIKERMRAEDAVYGGEMSAHHYFRDFAYCDSGNIPWLLVAELMSTTGKSLA
QLVDERIAAFPCSGEINYEVADVKATIENILAFYLPHNPEVDRTDGISVAFADWRFSLRG
SNTEPLLRLNVESRADSTLVERRVNEIARLIRS
Download sequence
Identical sequences V9UWJ5
gi|568180839|ref|YP_008953367.1| gi|568186270|ref|YP_008958796.1| WP_024086451.1.23948 WP_024086451.1.28354 WP_024086451.1.65739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]