SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182264|ref|YP_008954881.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182264|ref|YP_008954881.1|
Domain Number 1 Region: 4-169
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.7e-27
Family Clp protease, ClpP subunit 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568182264|ref|YP_008954881.1|
Sequence length 183
Comment Clp protease [Pseudomonas monteilii SB3078]
Sequence
MARHIVHFTGPINSSTCGNLINTCSRALQQGADVLQLNIATMGGECSYGFTLYNFLRALP
VEVHTHNLGTVESMGNIIFLAGERRTACSYSKFLFHPFHWTLHGSVDHSRMAEYAMSLDY
DLRLYAQIVAERTEGADEVLDVPRYLMAYPRILGPREALANGMIHAIDEMPIEAEACQWS
VHA
Download sequence
Identical sequences A0A1S2JQV1 J8VAG2 V9UY96
gi|568182264|ref|YP_008954881.1| gi|568187642|ref|YP_008960249.1| WP_003259457.1.1643 WP_003259457.1.23948 WP_003259457.1.28354 WP_003259457.1.56258 WP_003259457.1.65739 WP_003259457.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]