SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182310|ref|YP_008954927.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182310|ref|YP_008954927.1|
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 7.86e-94
Family Aldo-keto reductases (NADP) 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182310|ref|YP_008954927.1|
Sequence length 336
Comment NADP-dependent oxidoreductase [Pseudomonas monteilii SB3078]
Sequence
MIYRPLGHSGLQVSALTLGSMMFGEQTSTEDALRIIDKAWDQGINFIDTADVYNAGRAEE
IVGEAVARHRHDWIVASKVGFGPADGLPNRSGLSRKHIFNALDATLTRMDMDYLDIYYLH
REDHKVPLEETVQAIGDLLRQGKIRYWGVSNFRGWRIAEACHIAERLGVPRPVVSQPLYN
IVNRQAEPEQLTAAAAHGLGVVPFSPLARGVLSGKYAPGAVPDAGSRAGRQDKRIMEVEW
RQESLAIARQIQAYVEAKGVGIVEFAIAWVLNNRLVSSAIVGPRTEEQWDTYGGALAVKI
TAEDEAFIDSLVTPGHASTPGFNDVAHFVSGRITVH
Download sequence
Identical sequences A0A059UY82 A0A099MZG7 F8FWA1 V9V303
gi|568182310|ref|YP_008954927.1| gi|568187688|ref|YP_008960295.1| gi|339487655|ref|YP_004702183.1| WP_013972666.1.23948 WP_013972666.1.28354 WP_013972666.1.35335 WP_013972666.1.56258 WP_013972666.1.65739 WP_013972666.1.7288 WP_013972666.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]