SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182756|ref|YP_008955393.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182756|ref|YP_008955393.1|
Domain Number 1 Region: 13-174
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.01e-33
Family FAD-linked oxidases, N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 137-349
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.09e-19
Family Vanillyl-alcohol oxidase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182756|ref|YP_008955393.1|
Sequence length 350
Comment FAD-binding protein [Pseudomonas monteilii SB3078]
Sequence
MSMDRDISQALLEQVNQALNQATPLRIQGGNSKAMLGCPVAGEVLDTRSHRGIVSYDPTE
LVLTARAGTPLREIEAALHEAGQMLPCEPPHLGPDATLGGMVAAGLSGPRRPWAGSVRDY
VLGTRVITGHGKLLRFGGEVMKNVAGYDVSRLMAGSFGCLGLLTEVSLKVLPRPRQCLSL
RLPMGRHQALAELAEWGQQPLPISAACHDGDALYLRLEGGEGSVQSARQRLGGEALDSSF
WSDLREQRLAFFTGPAPLWRLSVPNTTGELDLPGQQLIDWGGAQRWLKSTAPAQHIREQV
AKVGGHATCHVPGAASSPPLPAALMRYHRALKQQLDPQGVFNPGRLYPDL
Download sequence
Identical sequences A0A059UYE8 V9V181
gi|568188134|ref|YP_008960761.1| gi|568182756|ref|YP_008955393.1| WP_024087334.1.23948 WP_024087334.1.28354 WP_024087334.1.35335 WP_024087334.1.65739 WP_024087334.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]