SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182797|ref|YP_008955435.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182797|ref|YP_008955435.1|
Domain Number 1 Region: 17-283
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 4.84e-34
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568182797|ref|YP_008955435.1|
Sequence length 299
Comment zinc ABC transporter permease [Pseudomonas monteilii SB3078]
Sequence
MSFEIFRQTVQDWATAGYLPEALAYGFVVNALLAGLMIGPVLGGLGTLVVVKRFAFFSEA
VGHAALTGVAIGILLGEPYTGPYGSLFGYCLLFGILLNFLRNRTGLSPDTLIGVFLSVSL
ALGASLLLMLAGKINVHILENVLFGSVLTVSGQDLVVLGIVAVLVLALAVPLYNRIMLAS
FNPQLAAVRGVAVKTLDYLFVVLVTLVTVASVKVIGAILVGALLVIPAAAARLVSQSLKG
FFFLSVLIATLSTLLGILLPIVFDLPVPSGAAIILVAGICFALTALARALVPRLQGNPA
Download sequence
Identical sequences V9V232
WP_024087349.1.23948 WP_024087349.1.28354 WP_024087349.1.7288 gi|568182797|ref|YP_008955435.1| gi|568188175|ref|YP_008960803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]