SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183358|ref|YP_008956024.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183358|ref|YP_008956024.1|
Domain Number 1 Region: 121-221
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 3.4e-19
Family KorB DNA-binding domain-like 0.0065
Further Details:      
 
Domain Number 2 Region: 29-148
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.0000000000000837
Family ParB-like nuclease domain 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|568183358|ref|YP_008956024.1|
Domain Number - Region: 318-381
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0068
Family Seryl-tRNA synthetase (SerRS) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568183358|ref|YP_008956024.1|
Sequence length 687
Comment plasmid stablization protein ParB [Pseudomonas monteilii SB3078]
Sequence
MNAVIQTEARAINTAAVIPLEAADPTKNLILVPLSRLVSRPAGRNVRKTPRMSIPELAAS
IQRVGLLQNLIVIAAADGEHYEVVAGGRRLAALKLLAKKHRISKEWDVPCLLVADGTART
ASLTENVQREAMHPADQFEAFAALVAEGRPIEDIAADFSVSPLVVQRRLKLANVSPRLLA
DYRAEAVTLDQLMALAITDDHAAQESAFYDAPTWQRQPSALRDRLTEREIDAYRHPLVRF
VGLDSYETAGGGIRRDLFAEGDAGVYLTDAALLERLAQDKLAGIAAEVKAEGWAWVDATP
AVTHADLHAFQRAPRERREPTKREAARIEKLQTKLHELAAAVDDALDADDEEEADALQEE
GEALGEQLQALEDGLQEYGPTVKAAAGAIVTTDRNGQAVIYRGLLREAEAKALRTLERLR
QGFSGEDAGNDDEGEDGDSEGQPKTAAMSDRLAQRLSAHRTAALQIEVARHPQVALAALV
HGMVQTVLQGGYHGHDLPLGVSLKVQDRLEGMAPDWPESPAAVALREFQQVAGEALPEDS
AELFAALLAKSQDELVRLLAVCVAVTVDVVTPRTTRQQPGEELAQAVRLDMAAWWKPTNE
GYFRHVPKAAILEAVERFAPSHVTRLAKLKKADIASEAERLADGTGWMPAIFKAEGPDAT
QAEPQEQDDAPEDAEATADEPSVALAA
Download sequence
Identical sequences V9V4L7
gi|568188731|ref|YP_008961387.1| WP_024087540.1.13208 WP_024087540.1.15328 WP_024087540.1.19930 WP_024087540.1.23948 WP_024087540.1.28354 WP_024087540.1.49266 WP_024087540.1.51472 WP_024087540.1.64433 WP_024087540.1.91585 gi|568183358|ref|YP_008956024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]