SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183617|ref|YP_008956297.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183617|ref|YP_008956297.1|
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.99e-27
Family Glutathione S-transferase (GST), N-terminal domain 0.00067
Further Details:      
 
Domain Number 2 Region: 75-197
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.87e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568183617|ref|YP_008956297.1|
Sequence length 209
Comment glutathione S-transferase [Pseudomonas monteilii SB3078]
Sequence
MSNPIKLYNFPKSGHAHRIELMLSLLNLPTELVFVDLAKGAHKQPDFLALNPFGQVPVID
DNGTVIADSNAILVYLAKKYDNGTWLPEEPAAAARVQRWLSVAAGPLAFGPAAARLVTVF
GASFNTDEVITRAHTLLKVIDAELAKTPFLAGSTPTIADIANYSYIAHAPEGNVSLEPYA
NVRSWLARIEALPRFVPMPRTVIGLQTSA
Download sequence
Identical sequences A0A059V507 A0A099N586 L0FP07 V7D4L0 V9V4B9
gi|431804037|ref|YP_007230940.1| 2035946184 gi|568183617|ref|YP_008956297.1| gi|568188990|ref|YP_008961660.1| WP_015271508.1.23948 WP_015271508.1.28354 WP_015271508.1.35335 WP_015271508.1.57632 WP_015271508.1.65739 WP_015271508.1.71677 WP_015271508.1.7288 WP_015271508.1.80759 WP_015271508.1.95946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]