SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183760|ref|YP_008956448.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183760|ref|YP_008956448.1|
Domain Number 1 Region: 12-193,264-340
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.56e-59
Family Crotonase-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183760|ref|YP_008956448.1|
Sequence length 368
Comment enoyl-CoA hydratase [Pseudomonas monteilii SB3078]
Sequence
MAIHCEVLTGADGARIGIATLDAPKALNALSLPMIEVLGEQLHAWARDPGIVCVLLRGNG
AKAFCAGGDVRALVQACRDHPGSVPPLAATFFAAEYRLDFALHTYPKPLLCWGHGHVLGG
GMGLLQGANVRIVTPSSRLAMPEISIGLYPDVGASWFLARLPGKLGLFLGLTGAPINAHD
ALDLGLADRFLGEYQQEALIEELLQLNWQEQTALQLNSLLKAEQHRVCAELPEAQWLPRR
QVIDQLLDVADAAAAWRALEGLKHHGDPLLADAGQRLHEGCPLTAHLVWEQIRRARHLSL
AQVFQMEYNMSLNCCRHPEFSEGVRARLLDKDNQPHWHWPDVAQVPAAVVEAHFAKVWEG
RHPLADLG
Download sequence
Identical sequences A0A059UWR7 F8G3B7 V9V748
gi|568183760|ref|YP_008956448.1| gi|568189133|ref|YP_008961811.1| gi|339489126|ref|YP_004703654.1| WP_013974012.1.23948 WP_013974012.1.28354 WP_013974012.1.35335 WP_013974012.1.56258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]