SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568183887|ref|YP_008956576.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568183887|ref|YP_008956576.1|
Domain Number 1 Region: 2-193
Classification Level Classification E-value
Superfamily SIS domain 2.43e-57
Family mono-SIS domain 0.0000000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568183887|ref|YP_008956576.1|
Sequence length 197
Comment DnaA initiator-associating protein DiaA [Pseudomonas monteilii SB3078]
Sequence
MDMQSRIRRLFQASIDTKQQAMDILAPHIEQASLVMVNALLNEGKMLACGNGGSAGDAQH
FSSELLNRFERERPSLPAIALTTDSSTLTSIANDYSYNEVFSKQIRALGQPGDVLLAIST
SGNSANVIQAIQAAHDREMIVVALTGRDGGGMASLLLPEDVEIRVPSTVTARIQEVHLLA
IHCLCDLIDSQLFGSEE
Download sequence
Identical sequences A0A059V5A4 A0A084C6T3 A0A099E4M8 A0A099N664 A0A0C5S0Z9 A0A0E9ZLP1 A0A0M2UDC6 A0A0S4I6P1 A0A132GDG6 A0A136QIU1 A0A147GDT0 A0A1L5PVK3 A0A1X7EY31 A0A212QTA7 A0A285Z5L2 A0A285ZHJ9 B0KFT9 F8G593 R9V8M1 V7D4U6 V9V539 V9WYU5
gi|568189260|ref|YP_008961939.1| gi|167035516|ref|YP_001670747.1| 2030865678 76869.PputGB1_4525 gi|512579405|ref|YP_008097154.1| gi|339489254|ref|YP_004703782.1| gi|512683891|ref|YP_008111871.1| 2035969068 WP_012274070.1.13472 WP_012274070.1.13892 WP_012274070.1.1467 WP_012274070.1.1643 WP_012274070.1.17209 WP_012274070.1.23948 WP_012274070.1.25194 WP_012274070.1.25404 WP_012274070.1.28354 WP_012274070.1.29846 WP_012274070.1.30017 WP_012274070.1.31265 WP_012274070.1.32670 WP_012274070.1.35335 WP_012274070.1.35716 WP_012274070.1.35841 WP_012274070.1.36363 WP_012274070.1.41505 WP_012274070.1.45096 WP_012274070.1.45121 WP_012274070.1.52768 WP_012274070.1.54657 WP_012274070.1.54759 WP_012274070.1.56258 WP_012274070.1.57327 WP_012274070.1.57632 WP_012274070.1.59340 WP_012274070.1.61619 WP_012274070.1.61620 WP_012274070.1.62816 WP_012274070.1.62999 WP_012274070.1.63009 WP_012274070.1.63899 WP_012274070.1.64740 WP_012274070.1.65173 WP_012274070.1.65540 WP_012274070.1.65739 WP_012274070.1.66485 WP_012274070.1.68951 WP_012274070.1.71677 WP_012274070.1.72310 WP_012274070.1.7288 WP_012274070.1.75217 WP_012274070.1.75421 WP_012274070.1.76210 WP_012274070.1.76632 WP_012274070.1.76710 WP_012274070.1.7826 WP_012274070.1.79655 WP_012274070.1.80759 WP_012274070.1.81634 WP_012274070.1.837 WP_012274070.1.84148 WP_012274070.1.87386 WP_012274070.1.9033 WP_012274070.1.91273 WP_012274070.1.92076 WP_012274070.1.9402 WP_012274070.1.96571 WP_012274070.1.98117 WP_012274070.1.99808 WP_012274070.1.99927 gi|568183887|ref|YP_008956576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]