SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568184088|ref|YP_008956779.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568184088|ref|YP_008956779.1|
Domain Number 1 Region: 1-127,237-267
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.74e-52
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000351
Further Details:      
 
Domain Number 2 Region: 128-237
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.42e-37
Family Dihydrodipicolinate reductase-like 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568184088|ref|YP_008956779.1|
Sequence length 268
Comment dihydrodipicolinate reductase [Pseudomonas monteilii SB3078]
Sequence
MRRIAVMGAAGRMGKTLVEAVQQQAPQAGLTAAIDRPDSSLVGADAGELAALGRIGVPIS
DDLSKVVDEFDVLIDFTHPSVTLKNLAFCRKAGKAMVIGTTGFTPEEKQQLAEAGKEIPI
VFAANFSVGVNLCLKLLDTAARVLGDDVDIEILEAHHRHKVDAPSGTALRMGEVVAQALG
RNLQEVAVYGREGQTGARERQTIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTF
AKGAVRAALWLDGREPGLYDMQDVLELR
Download sequence
Identical sequences A0A059V326 A0A099N625 F8G6I2 V7DDY9 V9V6P8 V9X5D5
gi|568189461|ref|YP_008962142.1| WP_013974295.1.23948 WP_013974295.1.28354 WP_013974295.1.35335 WP_013974295.1.52768 WP_013974295.1.56258 WP_013974295.1.61620 WP_013974295.1.65739 WP_013974295.1.7288 WP_013974295.1.76210 WP_013974295.1.76710 WP_013974295.1.80759 WP_013974295.1.92076 WP_013974295.1.9402 WP_013974295.1.99927 gi|568184088|ref|YP_008956779.1| gi|339489454|ref|YP_004703982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]