SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312134540|ref|YP_004001878.1| from Caldicellulosiruptor owensensis OL

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312134540|ref|YP_004001878.1|
Domain Number 1 Region: 55-343
Classification Level Classification E-value
Superfamily SIS domain 7.46e-74
Family double-SIS domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312134540|ref|YP_004001878.1|
Sequence length 354
Comment bifunctional phosphoglucose/phosphomannose isomerase [Caldicellulosiruptor owensensis OL]
Sequence
MLDNLETIAQNDPSGMFEAVYNLPEQIQKAYEIGKNISVKVKAEDIDKVVITGLGGSAIG
GNLLRVFVLDKCKIPVIVNRDYVLPAYVDSKTLVIASSYSGNTEETLSAYQDAKSKGAKI
IAITTGGKLKEFAEKDGFDVITIPSGLQPRAALGYSFIPLLMLFVKLGLIEPVDDQIEET
VKVLSDLRERYKPEVPEEKNLAKRLTLKLWNKLPIIYGISGTTEVIAERWKGQICENSKS
PAYFNVFSELNHNEIVGTESPKHILGLFEIVMLHDTEDHKRNAIRMDITKDLVKGVVSGV
NDIYSIGNSRLARMFSLIYLGDYVSLYLATLYQNDPTPVKKIDILKNKLAEIKD
Download sequence
Identical sequences E4Q4B6
WP_013411488.1.29544 gi|312134540|ref|YP_004001878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]