SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312135000|ref|YP_004002338.1| from Caldicellulosiruptor owensensis OL

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312135000|ref|YP_004002338.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily RNase III domain-like 9.77e-48
Family RNase III catalytic domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 108-219
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.62e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312135000|ref|YP_004002338.1|
Sequence length 222
Comment ribonuclease iii [Caldicellulosiruptor owensensis OL]
Sequence
MEEIEKALGYKFEDKNLLRLALTHKSATHSNKNCYERLEFLGDAALELAVSKYLYVYFPE
LSEGELTNIRAAVVCSQTLSKVAEKLNLKNHIIFGKREKMEKFYENKSILADVLEALFGA
IFIESGFDTVEKIIVNLLKPYIQKAVAGKLFYDYKTKLQEIVQREGQKKIVYKDCEILEK
KYFKSELFIEGKKVSEGYGTSKKEAQQDAAYKFLLEMGEQEE
Download sequence
Identical sequences E4Q6V5
gi|312135000|ref|YP_004002338.1| WP_013411927.1.29544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]