SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312135674|ref|YP_004003012.1| from Caldicellulosiruptor owensensis OL

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312135674|ref|YP_004003012.1|
Domain Number 1 Region: 627-825
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-19
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 2 Region: 370-613
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000161
Family Fibronectin type III 0.0055
Further Details:      
 
Weak hits

Sequence:  gi|312135674|ref|YP_004003012.1|
Domain Number - Region: 160-251
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00679
Family Fibronectin type III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312135674|ref|YP_004003012.1|
Sequence length 1201
Comment Fibronectin type III domain-containing protein [Caldicellulosiruptor owensensis OL]
Sequence
MRSITSRIISIFIVISFLIVLVPQNIVAQPAIVLPAPEKLNIALVNNLPRMEVAQDGTIT
LYFSWQYSYSDFDYFELYLGDDPTRFPYGYTIYKNDPNLTVSNSNYTYKVQSLPNGQKIP
SGIIFYAKIRSVRVLQEQTGSVVFYSSYSNTIVFLTPIFVECYTNAEDAIDIVWDDVYYS
GKRIDYDIYVSKDISFTTPTKYQIDGERITLLQSQKPGGRVEILPGRKLKYTAAGLSPSS
LYYVKVLPRNLPQEVIWRDPQTYMPPNIKVIGEAATYIQAEAQRIADNVVWIRWAKVSIA
ENEYEIYKGSKDQIPTLIGTVSANEFFAVVSITDDVFFRIQVDVFDSFGRKVSIRSKDLY
VHPYTLPFAPPAAENLIAFPKSQDTISLRFKIPTDKEVVYDFYYKKYLDNNTDFTLYVSN
YQMKSSDEEKDENNLLTGYYRFDITGLEKNTVYILKVVVKKRFFDYEQGTYIYKESTPAF
TISYTLSGDITPPAAPTLLSVVYTTYDSVVLSWQPITIAGVQPPTVDRSILYEVNFAVYQ
DGMNINNPENLDTASFQKIILSDYQLDSSGKILFRVSNLSSNTRYVFFVRAVRKIDNNVY
YSLPSNVVMATTLIKYEIPLPSSVPVVENLSVVTTTYNSAQLSWSYIENVYFEVQVSEDI
KNANAWQIVSDSFKPSIKEVDYTTGLCYFTVQNLKPDTLYYFRVRAYIIKDNQKIYSEFC
SPVFGRTQKIPPPKTPIAFGIKDYGKDYVVFVWEIAELGRKYVVEIADNISFYNAKKYTT
DTDATEYKVSGLKPNTRYWGRLFALASDGQLSQSTEIISFMTKKDVGEYTGVFDSIQDTT
QPFITVEDPVTGKMIIEITYRYVNESLDSKPVLIDFTRRTGSSIYQFVIKIRYDVLKALV
KLNKDCIVTLDGASSQFNFAAIDSIDINKLTVSGVSPSSIYSELTFIKASDKYNVKDAIS
EVYDIRYTASSLTKQIGISYFPMPIKISLVNREPWSVAIPHVFDLTSLSWREPDSVEFAS
DNKGVTFNLQTPQATVIVRKSFYRDIISSSYATKLYNLFKNFPSDDTNDTIGIKNAVSKQ
ELASFLVYFAEKKRLYRFEISDDYVRKAYKAGLIENTRDNSILTKEAAIDMMVKFYEIYT
GNEILADNVTWTKLSADDKYILSLKKAYKMGWLFDYVTFNPKETATREYVLAFFYHVVSS
I
Download sequence
Identical sequences E4Q458
WP_013412549.1.29544 gi|312135674|ref|YP_004003012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]