SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312794903|ref|YP_004027825.1| from Burkholderia rhizoxinica HKI 454

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312794903|ref|YP_004027825.1|
Domain Number 1 Region: 618-1095
Classification Level Classification E-value
Superfamily ALDH-like 7.85e-128
Family ALDH-like 0.000000245
Further Details:      
 
Domain Number 2 Region: 257-606
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-122
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000491
Further Details:      
 
Domain Number 3 Region: 87-256
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 5.62e-64
Family N-terminal domain of bifunctional PutA protein 0.000000358
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000408
Family PutA pre-N-terminal region-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312794903|ref|YP_004027825.1|
Sequence length 1307
Comment Proline dehydrogenase / Delta-1-pyrroline-5-carboxylate dehydrogenase [Burkholderia rhizoxinica HKI 454]
Sequence
MASTTLGVKVDDPLRTRLKEAALRLERTPHWLIKQAIFAYLEKIEHGTLPPELSLSHEVA
DAGESGIEPNDDASHPFLELAQNVQPQSVLRAAITAAYRRPEPECVPFLIGQARLAPPLA
SDVQVLATRLVEALRAKRTGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDALI
RDKISKGDWKSHVGHAPSLFVNAATWGLMITGKLVETNSEAGLSRALTRMIGKGGEPLIR
KGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEKDAQHYYALYE
QAIHAIGKAAGGRGIYDGPGISIKLSALHARYSRAQYERVMSELLPRVRALARLARRYDI
GLNIDAEEADRLEISLDLLEALCSDPELAGWNGIGFVVQAYQKRCPFVIDYLIDLARRSR
HRLMVRLVKGAYWDSEIKRAQVDGLEGYPVYTRKVYTDVSYLACAKKLLGVPDAVYPQFA
THNAHTLSAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRGKLNRPCRVYAPVGTHET
LLAYLVRRLLENGANTSFVNRIADESVPVAELVADPADEASRIVPLGAPHPKIPLPRALY
GSERANSMGLDLSNEHRLASLSSALLASTNVMWHAAPTLQPGEVVSGTPRLVRNPADQRD
VVGTVVDATAEHVQAALANALATAPIWQATPVQARADCLTRAADLLEAQIHTLMGLVVRE
AGKSLPNAIAEIREAIDFLRYYASQIRGEFSNDTHRPLGLIVCISPWNFPLAIFMGQVAA
ALAAGNTVLAKPAEQTPLIAAQAVRLLHEAGVPTGAVQLLPGDGETVGAALVADPRTRGV
MFTGSTEVARLINRTLSERLDPDGKPIPLIAETGGQNAMIVDSSALPEQVVADVLQSAFD
SAGQRCSALRVLCLQDDVAQHTLQMLTGAMRELSIGNPDRLSTDIGPVIDAEAKRGIEAH
IATMRDKGRKVFQLPLPDSCQHGMFVPPTLIEIDSIDELEREVFGPVLHVVRYRRHALES
LLEAIRATGYGLTLGVHTRIDETIGHVIERVHVGNIYVNRNVIGAVVGVQPFGGEGLSGT
GPKAGGPLYLYRLLAKRPNGIPASLARSLSEETPADGGPAAALTAFRDWLLGERDVQLAA
RCDGYLSQVLAGATATLPGPTGERNTYALSARGTVLCIASTASGARAQLAAVLATGNRAL
FIGASGEQLVGALPVALRSYAAVSRDGDLGVEYDAVLFEGDSDALQSLVRQIAARGGPIV
SVQSVVTGAFDEDAFGDDYALERLLTERSVSVNTAAAGGNASLMTIG
Download sequence
Identical sequences E5AKL0
WP_013433919.1.41379 gi|312794903|ref|YP_004027825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]