SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312795329|ref|YP_004028251.1| from Burkholderia rhizoxinica HKI 454

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312795329|ref|YP_004028251.1|
Domain Number 1 Region: 120-285
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.03e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 413-554
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.15e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00039
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.0095
Further Details:      
 
Domain Number 4 Region: 252-276,315-425
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.6e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312795329|ref|YP_004028251.1|
Sequence length 560
Comment sulfite reductase (Ferredoxin) [Burkholderia rhizoxinica HKI 454]
Sequence
MYQYDQYDQTSVDERVRQYADQVRRRLSGELTEEEFRPLRLQNGLYMQRHAYMHRIAVPY
GNLRSDQLRMLARIAREHDRGYGHFSTRSNMQFNWIKLEETPEILSKLASVQMHAIQTSG
NCIRNITADQFAGVAPDEIVDPRPWAELLRQWSTFHPEFAWLPRKFKIAVAGATQDRAAV
QLHDLGVYLKRDADGEVMCSVLVGGGMGRTPILGSIIKEDLPWQHLLTYCEAVLRVYNRF
GRRDNLFKARIKILVKALGKDKFSQQVEQEWQHLKDGPSTLTRDEVQRVAQHFAPPPYEK
LSDTDASFEQHLLENRAFARWVERNVSPHRVPGYAAVTLSLKPGAMWNYQPPGDVTDTQM
EALADWADVYSFGQLRVSHEQNLILANVKQRDLYTLWEKAREVGCGAPNVGLLTDIIACP
GGDFCSLANAKSIPIAQAIQQRFDDLDYVYDLGELSLNISGCMNSCGHHHVGNIGILGVD
KDGSEWYQVSLGGEQGNASALGRVIGPSFAADEVPEVITKVIDTFVEHRVEDERFIDTYK
RIGMAPFKQRVYAARQPAHA
Download sequence
Identical sequences E5AN26
WP_013434341.1.41379 gi|312795329|ref|YP_004028251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]