SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312796237|ref|YP_004029159.1| from Burkholderia rhizoxinica HKI 454

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312796237|ref|YP_004029159.1|
Domain Number 1 Region: 257-389
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 3.4e-24
Family Cell-division protein ZipA, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312796237|ref|YP_004029159.1|
Sequence length 407
Comment cell division protein ZipA [Burkholderia rhizoxinica HKI 454]
Sequence
MDELTLGLIGAGAVVVTGVVAYNAWQAAKVRRRMPRPMPDDAAAELARAPDANEERPFIE
PVAPGSRHESGFGANQAGARREPSFGPSAAPDTPVDLQAEGVGDGVGVAQAEPCPAHDGQ
QEPIMPAATTINAAPPALVDRRIDCVVPIRIAAPVAAEKVLPLAQRLRRAGGKPVFIEGK
AEGGEHWEWLQAGGRYHELRAAVQLANRNGPLNELEFSEFVSGVQAFADALDGAPEFPDM
METVSMARELDGFAAQCDAQLSVNVLSDGAPWSANYVQAVASQDGLLLSRDGTRFVKLDA
KQNPVFMLQFGDTNFLRDDLTYKGGTMITLLLDVPVADEDILPFRLMCDYAKSLAQRIGA
RVVDDQRRPLPETALAAIDTQLMTLYAKLEQAGIPAGSPATRRLFSN
Download sequence
Identical sequences E5AQY3
gi|312796237|ref|YP_004029159.1| WP_013435244.1.41379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]