SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312795002|ref|YP_004027924.1| from Burkholderia rhizoxinica HKI 454

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312795002|ref|YP_004027924.1|
Domain Number 1 Region: 243-605
Classification Level Classification E-value
Superfamily SIS domain 1.86e-109
Family double-SIS domain 0.00000000662
Further Details:      
 
Domain Number 2 Region: 2-232
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.29e-68
Family Class II glutamine amidotransferases 0.000000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312795002|ref|YP_004027924.1|
Sequence length 605
Comment glucosamine--fructose-6-phosphate aminotransferase [Burkholderia rhizoxinica HKI 454]
Sequence
MCGIVGAVAQRNIVPILVEGLRRLEYRGYDSCGVAAIVDGTARRARSVSRVTDLDQQIRD
TQLAGETGIAHTRWATHGAPVTHNAHPIFSHDTIALVHNGIIENYETLREGLRANGYEFV
TQTDTEVIAHLIYSLYRGDLFAAVREAVKQLHGAYAIAVFSKDQPHRVCGARAGSPLVVG
LGQQENFLASDALALAGSTDRFIFLEEGDVVELTLDGVRIADRDGGLVQREIRTVNAYGG
AVELGPYRHFMQKEIFEQPRAISDTMAQTDAFDPELFGAGAGDVFHGIDSLLILACGTSY
YSGLTAKYWLESIAKIPTQVEIASEYRYRDSVPNPRSLVVVISQSGETADTLAALKHAQA
LGHAHTLAICNVASSAMVRLTALRLLTHAGTEIGVASTKAFTTQLVALFVLAVTLGRLRG
HVDASLQAHYLKQLRHLPAALNSVLALEPQIIAWAEEFSRKENALFLGRGMHYPIALEGA
LKLKEISYIHAEAYPAGELKHGPLALVTEAMPVVTVAPNDALLEKLKSNIQEVRARGGQL
YVFADADTRIVNDEGLHVIRMPEHYGLLSPILHVVPLQLLAYHTACARGTDVDKPRNLAK
SVTVE
Download sequence
Identical sequences E5ALA7
gi|312795002|ref|YP_004027924.1| WP_013434016.1.41379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]