SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312797035|ref|YP_004029957.1| from Burkholderia rhizoxinica HKI 454

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312797035|ref|YP_004029957.1|
Domain Number 1 Region: 239-548
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.91e-58
Family Glucokinase 0.000000413
Further Details:      
 
Domain Number 2 Region: 652-813
Classification Level Classification E-value
Superfamily SIS domain 8.22e-35
Family mono-SIS domain 0.0075
Further Details:      
 
Domain Number 3 Region: 559-631
Classification Level Classification E-value
Superfamily Homeodomain-like 1.54e-17
Family RpiR-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312797035|ref|YP_004029957.1|
Sequence length 854
Comment RpiR family transcriptional regulator [Burkholderia rhizoxinica HKI 454]
Sequence
MTRARSKTRCRRRSATRCSRRWPRISARAVPRSRCRAAPARDRFCRLCRDARSTGRASTL
PWSTIAGSRRCMPTAMRDSCATRCCSTRRARPCSGRWSTSIKRPLPTSRHSTRMLRARCP
TWPCSAWEKMATRRRSSPTRRSGSWPHKPASAMCWSSRGRRRICGSACRCRRSGKSAGCF
CWSPGSASWMCCALRSSIHSTTPSPSWPTIRESTSMPTGAPKAVLARQSPHSDGPRLLAD
IGGTNARFALEFGPGQIDGIRVYSCADYPGIAAAIRKFLKDSGVGRVNHAAIAIANPVDG
DQVQMTNHNWSFSIEATRRALGFDTLLVVNDFTALAMALPSLSDAQRAQIGGGVRRQNSV
IGLLGPGTGLGVSGLIPANERWIALGSEGGHATFSPQDEREDRVLHYARKKWPHVSFERV
CAGPGLALIYRALAERDNKRLDTPLEPADVVRRAQAAEPLALEAVECFCAVLGTFAGNIA
VTLGALGGVYIGGGVIPHLGELFSTSPFRARFEAKGRFQAYLANIPTFVITAQYPALLGV
SAILAEQLGHHAGGGSAAFERIRQMRDVLTPAERRVADLALNHPRSIINDPIIDIARKAE
VSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTNPVSHSQVHLGDSATDFGAKVLDNTVSA
ILQLREQMNFDNVERAIDMLNSARRIEFYGLGNSNIVAQDAHYKFFRFGIPTIAYGDLYM
QAASAALLGKGDVIVAVSKSGKAPELLRTLEVAMQAGAQVIAITSSNTPLAKRASVALET
DPIEIRDAQLSMISRVLHLLVIDILAVGVAIRRALPDAGMQQVVEAVRGHADEDCAAVLD
WLSHGAALERRDTQ
Download sequence
Identical sequences E5ATD9
gi|312797035|ref|YP_004029957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]