SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312797320|ref|YP_004030242.1| from Burkholderia rhizoxinica HKI 454

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312797320|ref|YP_004030242.1|
Domain Number 1 Region: 104-284
Classification Level Classification E-value
Superfamily SIS domain 1.2e-30
Family mono-SIS domain 0.0063
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000896
Family RpiR-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312797320|ref|YP_004030242.1|
Sequence length 294
Comment RpiR family transcriptional regulator [Burkholderia rhizoxinica HKI 454]
Sequence
MSQTEPPVFDVVARIAQRLPALREAERKVAALILDDLCGSTRASIGELARRAGVSIATVT
RFAKAVGCRDVRELKWRLASAGAVGERFLREMRGGAHGSLAARILDEICATLVANVQLLD
AAPVTQAVDVLLAARMIYVFGMGGGSTALADELRFRLVRLGRPVATYQDAALQRMVASTL
SADTAVVALSATGQLPEIVASCQIAREYGASVVAITAPASPLASIAQTVIPLIAQETEFI
YKPSASRYAMMMALDVLVTELAVRQSDVSRDLLRRTKYALDMYRGGSERQPLGD
Download sequence
Identical sequences E5ALS7
WP_013436327.1.41379 gi|312797320|ref|YP_004030242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]