SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312797339|ref|YP_004030261.1| from Burkholderia rhizoxinica HKI 454

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312797339|ref|YP_004030261.1|
Domain Number 1 Region: 19-333
Classification Level Classification E-value
Superfamily SIS domain 3.34e-70
Family mono-SIS domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312797339|ref|YP_004030261.1|
Sequence length 335
Comment arabinose-5-phosphate isomerase [Burkholderia rhizoxinica HKI 454]
Sequence
MRVCYTPRMIAKINGARALQLAQHVLDIEAEAIRGLSTRLNGEFVVAVEMLLACKGRVVV
SGIGKSGHIARKLAATLASTGTPAFFVHPAEASHGDLGMVTADDVFIGLSNSGESEELIE
ILPLIKRLGAKLIAVTGRPESSLAKLADVHLNARVEKEACPLNLAPTASTTAALALGDAL
AVAVLDARGFSADDFARSHPGGTLGRRLLTYVRDVMRTGDEVPRVTLCATVRDALFEITA
KRLGMTAIVDGDSRVEGIFTDGDLRRVLEHKGDILGLPITDVMTHKPRTISAGQLAVEAV
ELMERFRINQMLVVGADGMLIGALNTHDLFSAKVI
Download sequence
Identical sequences E5ALU6
gi|312797339|ref|YP_004030261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]