SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312137954|ref|YP_004005290.1| from Rhodococcus equi 103S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312137954|ref|YP_004005290.1|
Domain Number 1 Region: 7-484
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 9.03e-203
Family Heme-dependent catalases 0.000000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312137954|ref|YP_004005290.1|
Sequence length 488
Comment catalase [Rhodococcus equi 103S]
Sequence
MTSIQPRPTTNDFGIPVNSDNESLTAGTQGPILLHDHYLIEKLAHFNRERVPERVVHAKG
GGAFGELVITGDVSKYTKAKFLQPGKKTESLVRFSTVAGEQGSPDTWRDPRGFAMKFYTE
DGNYDLVGNNTPVFFIKDPIKFPDFIHSQKRLPGSGLRDHNMQWDFWTLRPESAHQVTWL
MGDRGIPKTWRHMDGFGSHTYQWVNEAGERFWVKYHFKTDQGIEFLTQAEADELAGSDPD
HHRADLYDSIERGEFPSWTMKVQIMPVAEAEGYRFNPFDLTKVWSQKDYPLIEVGKWTLN
RNPENFFAQIEQASFEPSNVVPGIGFSPDKMLLGRVFSYADAHRYRIGANYAELPVNRPK
AEVNSYSQDGSMRYTFNSPSTPVYAPNSFGGPHADPTVAGDEGMWGFDGEAVRAGYIEHP
EDGDFTQAGTLVREVLDDAARERLVNNVVGHVLGGVKEPVLSRVFDYWKNVDAELGKKIE
EGVRAGQQ
Download sequence
Identical sequences A0A2I9DY92 A0A2K7VKT1 E4WCF0 E9SX72
gi|312137954|ref|YP_004005290.1| WP_005515946.1.17902 WP_005515946.1.24670 WP_005515946.1.25377 WP_005515946.1.30415 WP_005515946.1.30961 WP_005515946.1.33683 WP_005515946.1.41170 WP_005515946.1.42210 WP_005515946.1.49148 WP_005515946.1.55812 WP_005515946.1.57764 WP_005515946.1.58820 WP_005515946.1.66150 WP_005515946.1.67241 WP_005515946.1.69462 WP_005515946.1.69701 WP_005515946.1.73496 WP_005515946.1.75410 WP_005515946.1.78438 WP_005515946.1.91663 WP_005515946.1.95365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]