SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312139069|ref|YP_004006405.1| from Rhodococcus equi 103S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312139069|ref|YP_004006405.1|
Domain Number 1 Region: 80-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000458
Family NfeD domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312139069|ref|YP_004006405.1|
Sequence length 155
Comment nfed-like membrane protein [Rhodococcus equi 103S]
Sequence
MAALGVLALVVGVLLIVIEAHVPTYGALGVAGTLLAGTGAWLLFTSGGLGLEVALPVTLG
VAVVGLGAVAVTGRKVLSARREPVRTGAQSLVGSDALVRSWDGRQGQVELGGELWRARME
FGYTETPCSGESVVVEGVRGLTLSVRRREPWELPC
Download sequence
Identical sequences E4WFL6
WP_013415552.1.24670 gi|312139069|ref|YP_004006405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]