SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312139654|ref|YP_004006990.1| from Rhodococcus equi 103S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312139654|ref|YP_004006990.1|
Domain Number 1 Region: 81-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000366
Family NfeD domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312139654|ref|YP_004006990.1|
Sequence length 143
Comment integral membrane protein [Rhodococcus equi 103S]
Sequence
MAALIWLVAGVLLAAAEALVGEFFLLMLAGGALATAGFSAATDFPVWVDAVVFGVVSLVL
VLGVRPALLRRFEKPPLKLMNTEALPGKHALVLEEVGEHAGRVKLDGDVWTARPLDVSEV
YPPGTTVTVMEIDGATAVVWRGP
Download sequence
Identical sequences A0A2I9DUI8 A0A2K7V4G5 E4WHA1
WP_013415972.1.101992 WP_013415972.1.17902 WP_013415972.1.21301 WP_013415972.1.24670 WP_013415972.1.24914 WP_013415972.1.25377 WP_013415972.1.26605 WP_013415972.1.29654 WP_013415972.1.30415 WP_013415972.1.30961 WP_013415972.1.3120 WP_013415972.1.33683 WP_013415972.1.42210 WP_013415972.1.45807 WP_013415972.1.46997 WP_013415972.1.49148 WP_013415972.1.55812 WP_013415972.1.56845 WP_013415972.1.57764 WP_013415972.1.58820 WP_013415972.1.63555 WP_013415972.1.64098 WP_013415972.1.64792 WP_013415972.1.66150 WP_013415972.1.67241 WP_013415972.1.70339 WP_013415972.1.73496 WP_013415972.1.75410 WP_013415972.1.7670 WP_013415972.1.78438 WP_013415972.1.8225 WP_013415972.1.89238 WP_013415972.1.91663 WP_013415972.1.95365 gi|312139654|ref|YP_004006990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]