SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330815060|ref|YP_004358765.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330815060|ref|YP_004358765.1|
Domain Number 1 Region: 7-159
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.19e-38
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330815060|ref|YP_004358765.1|
Sequence length 159
Comment AraC family transcriptional regulator [Burkholderia gladioli BSR3]
Sequence
MTNPQLDIRQLAPLEVVAAAHIGPYAEMHAAFSRLAAWLDEQGQFGPDTQCLGIFHDDPE
AVPAAQLRSHACFALGEGTTALALPGQFEHLTISGGPYAVLIHRGPYARLGESYRWLFQE
WLPASGHAPAEAPSFERYLNDPRDTPAEQLLTEICLPLR
Download sequence
Identical sequences F2LH82
WP_013696189.1.70250 WP_013696189.1.77502 gi|330815060|ref|YP_004358765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]