SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330817548|ref|YP_004361253.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330817548|ref|YP_004361253.1|
Domain Number 1 Region: 15-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.62e-78
Family Acetamidase/Formamidase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330817548|ref|YP_004361253.1|
Sequence length 412
Comment formamidase [Burkholderia gladioli BSR3]
Sequence
MTDTLIKVDLNQSAYENAQVHNRWHPDIPMACWVNPGDDFILETYDWTGGFIKNDDSADD
VRDIDLSIVHFLSGPVGVKGAEPGDLLVVDLLDIGAKSDSQWGFNGFFSKTNGGGFLTDH
FPSAQKSIWDFHGMYTSSRHIPGVNFAGLIHPGLIGCLPDPKLLETWNARETGLIATNPE
RVPPLANPPFAATAHMGSLSGEAKARAAAEGARTVPPREHGGNCDIKDLSRGSKVFFPVY
VDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMRVNLIKGGVAKYGIRNPVFQPSPITP
NYNDYLIFEGISVDETGGQHYLDVTVAYRQACLNAIEYLKKFGYSGAQAYSLLGCAPVQG
HISGVVDIPNACATLWLPTQIFDFDIRPNAEGPIRHVKGEVDLPISYDLVKA
Download sequence
Identical sequences F2L8S1
gi|330817548|ref|YP_004361253.1| WP_013698624.1.70250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]