SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330818587|ref|YP_004362292.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|330818587|ref|YP_004362292.1|
Domain Number - Region: 101-134
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00798
Family Phase 1 flagellin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330818587|ref|YP_004362292.1|
Sequence length 141
Comment flagellar basal-body rod protein FlgC [Burkholderia gladioli BSR3]
Sequence
MPSLMNIFDVAGSAMSAESQRLNVTASNLANADSVTGPDGKPYRAKQVVFETQPVGNART
RSGQGVGGVQVKQVIDDPSPMKTNYDPSNPAADANGYVTMPNVDPVQEMVNMISASRSYQ
ANVETLNTAKQLMLKTLTIGS
Download sequence
Identical sequences A0A0M2Q6A1 F2LFY5
WP_013699651.1.10250 WP_013699651.1.70250 WP_013699651.1.7600 WP_013699651.1.77502 WP_013699651.1.80089 gi|330818587|ref|YP_004362292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]