SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330819752|ref|YP_004348614.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330819752|ref|YP_004348614.1|
Domain Number 1 Region: 10-104,143-159,196-321,356-420
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.18e-53
Family Acetamidase/Formamidase-like 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|330819752|ref|YP_004348614.1|
Domain Number - Region: 108-137
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0602
Family RBP12 subunit of RNA polymerase II 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330819752|ref|YP_004348614.1|
Sequence length 435
Comment acetamidase/formamidase [Burkholderia gladioli BSR3]
Sequence
MKTSPVQRLTVNTYTHGLLGPGQPMLGPLANGGTLVAGTPPGCWGPMITPSFEGGHEVTQ
PVAIDGAEIGDAVALTIRRMRVTSLATSSGVMAFVEGRYHGDPFVAKFCASCGTEHPASH
VEGIGADAIRCDHCGAETNAFRFRHGYVIVFDHENQLGVTVDQSAADRLARQAPAMSALT
ELASQHSILSLARADMPGVAAPMRPFLGNLGTTPSRDLPDSHNCADFGQYLVGAPHRYTM
THDELHAAKTDGHMDSNSVREGCIVICPVKVPGAGVYLGDMHAQQGNGEIAGHATDVSGE
TELSVELIKHLTIDGPILLQNLDDLPPMARPMNAEQRRQAVELARRWGQESVEQSGPITF
IGSGANLNEATEVGLRRAAAVTGLPYEEILNRATLTGSIDISRLPGTVRVTLLCPMSILD
RIGIGHLVRDKYGIE
Download sequence
Identical sequences F2LJQ8
WP_013689434.1.70250 gi|330819752|ref|YP_004348614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]