SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330820175|ref|YP_004349037.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330820175|ref|YP_004349037.1|
Domain Number 1 Region: 178-474,553-594
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.22e-87
Family Type II chitinase 0.00000000241
Further Details:      
 
Domain Number 2 Region: 474-552
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.69e-17
Family Chitinase insertion domain 0.0000614
Further Details:      
 
Domain Number 3 Region: 993-1048
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000011
Family Carbohydrate binding domain 0.0043
Further Details:      
 
Domain Number 4 Region: 40-161
Classification Level Classification E-value
Superfamily E set domains 0.000000000308
Family E-set domains of sugar-utilizing enzymes 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|330820175|ref|YP_004349037.1|
Domain Number - Region: 822-875
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0123
Family Carbohydrate binding domain 0.0029
Further Details:      
 
Domain Number - Region: 894-981
Classification Level Classification E-value
Superfamily PKD domain 0.0141
Family PKD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330820175|ref|YP_004349037.1|
Sequence length 1050
Comment chitinase [Burkholderia gladioli BSR3]
Sequence
MKNTQPGRSGIHSKLSPVNRNARLAIAMASALCFANAAFAAPGAPALKAWEITSKPHGFV
QIELDKAGAVPYKDLVRINKAVDVPLPFDIYYNGTAVKALAVVDGVADEASAISMTGTGG
TQKGSVVAHVTRPGKKQMQVRVFDDKGAFTDSAPLEVMVFDTTPELADDLPDNADKANRP
FRNTSGSVVGSYFATWSIYGRKFSVDQVPVENLTHMLYGFVPICGGAGINDSLAAMGGTS
YNALQLSCRGLPDFSVAIHDGWGEIGATLPGQSASSKLKGVLGQMMAAKKRNPELKILPS
IGGWTLSDPFHHLHDASKRRVFVDSVEQFLRTWKFFDGVDIDWEFPGGKGANASLGDPLK
DGPLYVTLMKELRQMLDRLSRDTGKIYQLTSAIGSGDDKIAVVDYREASKYMDYIFDMSY
DFYGAWSMSDLGHQTALNAPAWRPDTAYTTANSVKALLAQGVKPGKIVVGAAMYGRGWTG
VSGYQGDNPFTGTARGPVKGDWENGILDYKSIAARMLGPGGHGINGYEYHYDQTAEAPYV
FNKANGDLVSFDDTRSVAAKGEYVRKLGLGGLFSWEIDADNGDILNAMHSGLGHEAREGS
APNRAPLARTGGDLTVDHAGLVTLDASKSSDPEGGKLRFAWKQASGPALSIANADSAKAS
VEIPAVKTDTRFVFEVTVTDAGGLDAKARTSVLAKASASGGNGKPQEPSQPGKNHPPVAQ
LSGPDTVQAGESIKLSAARSSDADGDKLGYRWLMPAGFPAAKNQSTLTVEAPELASDTRL
SFTVEVSDGKLSSRATHTVLVKARQQKPGGGSGSSSGNGGNAGQYPAYQQGTPYKAGDIV
SNGGKLYRCKPHPATGWCAGAAWAYAPGSGSAWQQAWDLHGDAEPGKPARPGENHAPVAK
LSGPDSTRAGQAVTLSAAGSIDADGDPLSFKWNVPAGIRASQDGATLRFDAPELPRDTKF
DFSVSASDGKLSSSARHTVLVKGKQAGGSEGGQCAAAWQGGKPYTGGSRVQHQGRLYEAR
WWTSNEPGSPETTGPDFSGKVWKDLGECGK
Download sequence
Identical sequences F2LL47
gi|330820175|ref|YP_004349037.1| WP_013689852.1.70250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]