SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330821825|ref|YP_004350687.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|330821825|ref|YP_004350687.1|
Domain Number - Region: 15-63
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0275
Family Chitinase insertion domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330821825|ref|YP_004350687.1|
Sequence length 72
Comment hypothetical protein bgla_2g27570 [Burkholderia gladioli BSR3]
Sequence
MGIIKISESMHDSLRRTSGALSRSINAQAEHWLRVGMLAELNPTLSYGEICQMLLRAEVQ
QAPDETSLPQVA
Download sequence
Identical sequences A0A095WD92 F2LR08
gi|330821825|ref|YP_004350687.1| WP_013691499.1.10250 WP_013691499.1.1979 WP_013691499.1.34339 WP_013691499.1.40080 WP_013691499.1.51104 WP_013691499.1.70250 WP_013691499.1.7600 WP_013691499.1.77502 WP_013691499.1.80089 WP_013691499.1.81858 WP_013691499.1.97841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]