SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330815707|ref|YP_004359412.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330815707|ref|YP_004359412.1|
Domain Number 1 Region: 11-332
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.33e-111
Family DAK1 0.000000285
Further Details:      
 
Domain Number 2 Region: 370-572
Classification Level Classification E-value
Superfamily DhaL-like 7.98e-48
Family DhaL-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330815707|ref|YP_004359412.1|
Sequence length 575
Comment Glycerone kinase [Burkholderia gladioli BSR3]
Sequence
MKKLINDVEHVVPDLLNGLVALNPHLALLAGRTIVVRADAAEAASRGEVALISGGGAGHE
PAHAGYVGAGMLSAAVAGEVFTSPSVDAVLDAIRAVAGPAGVLLIVKNYTGDRLNFGLAA
EIARAEGIDVETVIVADDVALAARGEHAGRRGLAGTVLVHRIAGAAAAAGLPLAEVARQA
REAAAALGTMGVALSPCTVPAAGTPGFTLGEREIEWGLGIHGEAGVERAELESAEAVAAR
LIARIAEDLALERGARVALLVNNLGGTPPGELDIVADAALRALAARGAVVERAWAGTFLS
ALEMAGISLSLLRVDEARLAALDSPTEAPAWPARAGRVAPQESRPVPAAPEAARRTQGEG
EGPRLARDAVLRRVIDAVCLKLRESEALLTEMDQRVGDGDLGISLSRAAQAIEAEAGGWP
DAARPGAVLRAMSATLRRVVGGTSGPLYAAMLMRAAASLDAAARPDAPAWAEAFVAAVEG
VSEIGGARPGDRTMVDALDPAARAMRAALDADGGNLRQALDAAAAAAIEGAAGTAALLPR
RGRSSYLGERALGHPDPGAHAVGLWLAAIRDALRD
Download sequence
Identical sequences F2L7S7
gi|330815707|ref|YP_004359412.1| WP_013696812.1.70250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]