SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330816144|ref|YP_004359849.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330816144|ref|YP_004359849.1|
Domain Number 1 Region: 439-579
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.88e-32
Family Flavohemoglobin, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 334-433
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.02e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0006
Further Details:      
 
Domain Number 3 Region: 567-678
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.98e-19
Family 2Fe-2S ferredoxin-related 0.018
Further Details:      
 
Domain Number 4 Region: 175-291
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000106
Family PNP-oxidase like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330816144|ref|YP_004359849.1|
Sequence length 690
Comment pyridoxamine 5'-phosphate oxidase-related FMN-binding protein [Burkholderia gladioli BSR3]
Sequence
MKLTQTETASPWHEGELAIQRRTGVAGKMHEVGRRVVRDYMPDQHREFYAQLPFIAFGAV
DERGDAWASFLSGHPGFMQSPEPGRLHVEAGVDPADPAAPGLYEGAAIGLLGIELHTRRR
NRMNGTLRAHTAGGFDVQVRQSFGNCPQYIQLRDFGFVREPSQYTDIAPLEFDHLDARAR
GIIAAADTFFVASYVGEGEARQVDVSHRGGNAGFVRIDEDGRLTVPDFAGNLFFATLGNF
LVNPRAGLVFVDFETGDMLQMTGEASVELESEEIAAFQGAERLWHFKPRRVIHRRQAMPL
RWRFRADGWSPNSLMTGSWDEAASRLKAAALAHAWRPFEVTRIVDETPAIRSFHLQPADG
AGLLPHAAGQHLPIRVTPPGQERALIRTYTLSTAPSDGVYRISVKRDGLVSAYLHDTLRL
GSTLETRAPAGAFTIDAAQTRPAVLLAAGVGVTPMLAMLRHIVYEGLRKRRVRPTWFFHS
ARSLGERAFSAEIAQLAAASKGAVTVVRALSDTVGAQAHEDYDFGGRLDIALLRRTLPFD
DYDFYLCGPGGFMQSMYDALRDLNVADARIHAEAFGPSGLQRRRDAATAAAPAREPATEP
TPVAFVKSGKEARWQPDGGSLLELAEARGLAPEYGCRSGSCGSCRARVVEGAVAYPRAPE
FEVAEGEALICCAVPASPASGGGSRLLLDL
Download sequence
Identical sequences F2LC85
gi|330816144|ref|YP_004359849.1| WP_013697242.1.70250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]