SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518650732|ref|YP_008140272.1| from Serratia plymuthica 4Rx13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518650732|ref|YP_008140272.1|
Domain Number 1 Region: 10-371
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.54e-110
Family FMN-linked oxidoreductases 0.000000000708
Further Details:      
 
Domain Number 2 Region: 342-528
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.77e-43
Family N-terminal domain of adrenodoxin reductase-like 0.00000533
Further Details:      
 
Domain Number 3 Region: 469-536,575-659
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.09e-25
Family C-terminal domain of adrenodoxin reductase-like 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|518650732|ref|YP_008140272.1|
Sequence length 681
Comment 2,4-dienoyl-CoA reductase [NADpH] FadH [Serratia plymuthica 4Rx13]
Sequence
MKDAMETAMSNYPHLLAPLDLGFTTLKNRVLMGSMHTGLEELPDGPERMAAFYAERAAAG
VALIVTGGIAPNEKGVVYRGGSTLSRRDQVDHHRIVTDAVHQAGGKIALQILHAGRYSYQ
PQPVAPSALQAPINPFAPTALSEAEIEQTIADFAHCALLAQQAGYDGVEVMGSEGYLINQ
FLVSRTNQRDDSWGGSFSNRMRFAVEIVRAVRQAVGREFILIYRLSMLDLVEDGSSWQEI
EQLALAIEQAGATLINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVRIPLITTNRIN
DPAVAEQVLADGCADMVSMARPFLADAAFVQKAAEGRADEINTCIGCNQACLDQIFEGKL
TSCLVNPRACRETEMPLTMAEKPKKLAVIGAGPAGLAFATTAASRGHRVTLFDAVDQIGG
QFNIAKQIPGKEEFHETLRYFRRQLALLEVTVKLGTQVEAADLAEFDEVILACGIVPRTP
AIPGIDNAKVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQHGVSSSLDQAEFNRE
WGIDGQLSQRGGLAAQGPVAERGPRQIYLLQRKTSKVGEGLGKTTGWIHRASLLMRGVKM
LNSVNYQRIDEEGLHISRAEQESCLPVDTVIICAGQEPRRELQQPLLAMGKTVHLIGGAD
VAAELDARRAIDQGTRLAMAL
Download sequence
Identical sequences S0AJL4
gi|518650732|ref|YP_008140272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]