SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310659019|ref|YP_003936740.1| from Clostridium sticklandii DSM 519

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310659019|ref|YP_003936740.1|
Domain Number 1 Region: 165-355
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.32e-61
Family Methylesterase CheB, C-terminal domain 0.00000588
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily CheY-like 3.56e-29
Family CheY-related 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310659019|ref|YP_003936740.1|
Sequence length 357
Comment fused chemotaxis regulator ; protein-glutamate methylesterase in two-component regulatory system with CheA [[Clostridium] sticklandii]
Sequence
MQSIKVLIVDDSAFIRKMLKDLLEIDASIKVVAAVKNGKEAIEFLESSYVDVITLDVEMP
VMDGIATLKEIMRVRPTPVVMLSSLTKEGAEMTFKALDLGAVNFLAKPTNIFKISSSADI
QDSIIDKVKEASKVRVNKIAAIRPKDNKISYTESSSMNSSIKNSDIKKIVAIGTSTGGPR
ALQEVISNLSGSFPAPVLIVQHMPKGFTKSLADRLDSISRIRVKEAEDNEIVENATVYIA
PGDRHLKIEAFSKNKYRIRLDDGPNVSGHKPSVDALFYSLCDVPTNDIITVIMTGMGADG
AKAMEQLKLIKKSTTIVEDESTCVVFGMPKSAIATGKVDKILPLNKIAAELNKMLGV
Download sequence
Identical sequences E3PSI1
gi|310659019|ref|YP_003936740.1| WP_013361928.1.92012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]