SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310659142|ref|YP_003936863.1| from Clostridium sticklandii DSM 519

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310659142|ref|YP_003936863.1|
Domain Number 1 Region: 74-146
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000549
Family Apolipoprotein 0.0095
Further Details:      
 
Weak hits

Sequence:  gi|310659142|ref|YP_003936863.1|
Domain Number - Region: 23-81
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0392
Family FtsH protease domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310659142|ref|YP_003936863.1|
Sequence length 149
Comment Archaeal/vacuolar-type H+-ATPase subunit H [[Clostridium] sticklandii]
Sequence
MEVLNLLELLEDIIEEGSKLPFGNKVMIDKSKALEILRDVRISLPDEVKQAEWINTERQR
IIDDAKEEAEKMIKDTEDYIKQKVADSEITKKAQENAKEIIEKAENKAKDLKDGSREYAI
EVLKKLDTDLGKLNSRLQKNMQELREFDL
Download sequence
Identical sequences A0A1T4ZYZ8 E3PSV4
WP_013362050.1.6884 WP_013362050.1.92012 gi|310659142|ref|YP_003936863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]