SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310659440|ref|YP_003937161.1| from Clostridium sticklandii DSM 519

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310659440|ref|YP_003937161.1|
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily L28p-like 4.32e-26
Family Ribosomal protein L31p 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310659440|ref|YP_003937161.1|
Sequence length 65
Comment 50S ribosomal subunit protein L31 [[Clostridium] sticklandii]
Sequence
MKANIHPEYKEVQVHCACGNTFMAGSTNEEIRVEICSQCHPFYTGQAKSIEKGGRIERFN
KKFNR
Download sequence
Identical sequences E3PTQ2
WP_013362348.1.92012 gi|310659440|ref|YP_003937161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]