SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479177906|ref|YP_007805507.1| from [Ruminococcus] obeum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479177906|ref|YP_007805507.1|
Domain Number 1 Region: 440-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000824
Family Anti-sigma factor antagonist SpoIIaa 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479177906|ref|YP_007805507.1|
Sequence length 716
Comment Sulfate permease and related transporters (MFS superfamily) [Ruminococcus obeum A2-162]
Sequence
MNLRLFPTLKNYNLRNLPGDIFSGIIIAAVSIPISMGYAQISGIPAIYGLYGSVFPILFF
ALFSTSKQFIFGVDAAPAAIVGSALASLGIAAESPDALACVPVIAFFAGLWLLIFYFLHA
DRIVDFISTPVMGGFISGISLTIILMQIPKLMGRDAGSGELPELLHYIFLAARSISLLSL
AMGISALILIRIGKKIFPKVPMSIVIMILGVLSTTCFHVQNHGVVLLQAVEPGFPTFLIP
KFGEVALTQTVGRGLMVAVVIMAETLLAENNFAFKNGYKLNDRQEILACAAGNISASFVG
CCPVNGSISRTAMNEQYGGTSQVVSLTAGITMAVLLFGFTGFIGYLPVPVLTAIVISALM
DVVEVHLAIRLYKVSRNEFYIFMAACISVLFLGTIYGVLIGIILSFVAVILKATAPPRSF
RGIIPGKESYYDLGRNRHAYPIQHVIIYRFNENLFFANAKVFQEDLENSLKEDTKVVIVD
ASSINSIDITAADRIEAIASNMKRRGIQFYITEHSSSLNEQMRTLGIGHLIKEGCVRRTI
LAALNDAGIHRPYNLEIPESEKKLAELRSHSHLPAEEEDTLEEFAWAFGKETVQELEQAT
HTIIEHLHQMPDIERLSDEGIKEHFESWHTLGALDEDEILHRIELHIDELPEEMHKEHRH
IVELIEKRRTRIREKVLEEHPELAARLEQNRIRLEKRLEKQNPEALRKWREWKKRE
Download sequence
Identical sequences D4LRW7
gi|479177906|ref|YP_007805507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]