SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386038742|ref|YP_005957696.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386038742|ref|YP_005957696.1|
Domain Number 1 Region: 18-245
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.54e-62
Family PP-loop ATPase 0.00014
Further Details:      
 
Domain Number 2 Region: 351-469
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.88e-21
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0071
Further Details:      
 
Domain Number 3 Region: 225-331
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000000366
Family MesJ substrate recognition domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386038742|ref|YP_005957696.1|
Sequence length 482
Comment tRNA(Ile)-lysidine synthase [Paenibacillus polymyxa M1]
Sequence
MGTTKPTGVVQEVLALAREHSLWSPGDRIVVAVSGGPDSVALLHILHEISVIHMPLQLVC
AHVHHGFRPEESDAEAEEVHNIARKLKLPFEMIRVDAPAYMKESGKGPQEAARELRYSFL
HDTATKWKAQHIAMAHHGDDQAETVLLHLLRGSGPAGLAGMRLARNEKNVQLIRPLLRMY
KADLIEYCNFHGFSYVTDSTNLSSKYRRNAIRMDVLPFLGQYNEQLTPSLNRLAETMADE
NDFMEAATLSAYEKMVHFNNGRYMFSIASYRKLSVALQRRLIKLILNYLPSGSENFDFRK
IETVRLRLLQETSSTWSLDLGGGAVGVREYDQAVLFDRTQVVMGEWSYGLSVLPISGELE
LPEAGGILRWRRASYWDGHHPANEEEAWFDADELTLPLTVRSRLPGDTMYVMGLNGRKKV
KDIFIDEKIPPLMRSVIPIVCDHSGVVLWIPGVRRSVHAAVQKHTSSVIYMSWQRRESPG
HQ
Download sequence
Identical sequences E3EDX9
WP_013368692.1.14980 WP_013368692.1.6267 WP_013368692.1.91857 gi|386038742|ref|YP_005957696.1| gi|310639528|ref|YP_003944286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]